Lineage for d1uwgy1 (1uwg Y:3-113)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 450780Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (27 proteins)
  6. 450916Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 451214Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (143 PDB entries)
  8. 451350Domain d1uwgy1: 1uwg Y:3-113 [100121]
    Other proteins in same PDB: d1uwgh2, d1uwgl1, d1uwgl2, d1uwgx1, d1uwgx2, d1uwgy2
    part of catalytic Fab 14d9

Details for d1uwgy1

PDB Entry: 1uwg (more details), 2.79 Å

PDB Description: molecular mechanism of enantioselective proton transfer to carbon in catalytic antibody 14d9

SCOP Domain Sequences for d1uwgy1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uwgy1 b.1.1.1 (Y:3-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2}
qllesgpelvepgasvkvsckasaysitdfniywvkqshgknlewiggidphnggpvynq
kfngkatltvdkssstafmhlnsltsedsavyycaifygnffdywgpgttvtvss

SCOP Domain Coordinates for d1uwgy1:

Click to download the PDB-style file with coordinates for d1uwgy1.
(The format of our PDB-style files is described here.)

Timeline for d1uwgy1: