Lineage for d1uwgx2 (1uwg X:108-213)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2020524Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2023413Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)
  7. 2023414Species Human (Homo sapiens) [TaxId:9606] [88569] (144 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
    SQ NA # humanized antibody ! Uniprot P01834 # KAC_HUMAN Ig kappa chain C region ! SQ P01834 # KAC_HUMAN Ig kappa chain C region. ! SQ NA # engineered antibody
  8. 2023569Domain d1uwgx2: 1uwg X:108-213 [100120]
    Other proteins in same PDB: d1uwgh1, d1uwgh2, d1uwgl1, d1uwgx1, d1uwgy1, d1uwgy2
    part of catalytic Fab 14d9
    complexed with kha, po4

Details for d1uwgx2

PDB Entry: 1uwg (more details), 2.79 Å

PDB Description: molecular mechanism of enantioselective proton transfer to carbon in catalytic antibody 14d9
PDB Compounds: (X:) antibody 14d9

SCOPe Domain Sequences for d1uwgx2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uwgx2 b.1.1.2 (X:108-213) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreaavawkvdnalqsgnsqesvteqd
sadstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

SCOPe Domain Coordinates for d1uwgx2:

Click to download the PDB-style file with coordinates for d1uwgx2.
(The format of our PDB-style files is described here.)

Timeline for d1uwgx2: