SCOP 1.67: Domain d1uwgx1: 1uwg X:1-107

Lineage for d1uwgx1 (1uwg X:1-107)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (160 PDB entries)

8. Domain d1uwgx1: 1uwg X:1-107 [100119]
   Other proteins in same PDB: d1uwgh1, d1uwgh2, d1uwgl2, d1uwgx2, d1uwgy1, d1uwgy2
   part of catalytic Fab 14d9
   complexed with kha, po4

Details for d1uwgx1

PDB Entry: 1uwg, 2.79 Å

PDB Description: molecular mechanism of enantioselective proton transfer to carbon in catalytic antibody 14d9

SCOP Domain Sequences for d1uwgx1:

Sequence; same for both SEQRES and ATOM records:

>d1uwgx1 b.1.1.1 (X:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4}
elvmtqspkfmstsvgdrvsvtckasqnvgthvawyqqkpgqspktliysasyrysgvpd
rftgsgsgtdftltirdvqsedaaeyfcqqynlfpvtfgggtkleik

Timeline for d1uwgx1:

• d1uwgx1 is new in SCOP 1.67
  
• d1uwgx1 appears in SCOP 1.69
  
• d1uwgx1 appears in the current release, SCOPe 2.08