SCOPe 2.05: Domain d1uwgl2: 1uwg L:108-213

Lineage for d1uwgl2 (1uwg L:108-213)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88569] (144 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)
   SQ NA # humanized antibody ! Uniprot P01834 # KAC_HUMAN Ig kappa chain C region ! SQ P01834 # KAC_HUMAN Ig kappa chain C region. ! SQ NA # engineered antibody

8. Domain d1uwgl2: 1uwg L:108-213 [100118]
   Other proteins in same PDB: d1uwgh1, d1uwgh2, d1uwgl1, d1uwgx1, d1uwgy1, d1uwgy2
   part of catalytic Fab 14d9
   complexed with kha, po4

Details for d1uwgl2

PDB Entry: 1uwg, 2.79 Å

PDB Description: molecular mechanism of enantioselective proton transfer to carbon in catalytic antibody 14d9

PDB Compounds: (L:) antibody 14d9

SCOPe Domain Sequences for d1uwgl2:

Sequence; same for both SEQRES and ATOM records:

>d1uwgl2 b.1.1.2 (L:108-213) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreaavawkvdnalqsgnsqesvteqd
sadstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

Timeline for d1uwgl2:

• d1uwgl2 first appeared in SCOP 1.67
  
• d1uwgl2 appears in SCOPe 2.04
  
• d1uwgl2 appears in SCOPe 2.06
  
• d1uwgl2 appears in the current release, SCOPe 2.08