Lineage for d1uwgl2 (1uwg L:108-213)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 452577Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 453918Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 453919Species Human (Homo sapiens) [TaxId:9606] [88569] (78 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
  8. 453996Domain d1uwgl2: 1uwg L:108-213 [100118]
    Other proteins in same PDB: d1uwgh1, d1uwgh2, d1uwgl1, d1uwgx1, d1uwgy1, d1uwgy2

Details for d1uwgl2

PDB Entry: 1uwg (more details), 2.79 Å

PDB Description: molecular mechanism of enantioselective proton transfer to carbon in catalytic antibody 14d9
PDB Compounds: (L:)

SCOP Domain Sequences for d1uwgl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uwgl2 b.1.1.2 (L:108-213) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens)}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreaavawkvdnalqsgnsqesvteqd
sadstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

SCOP Domain Coordinates for d1uwgl2:

Click to download the PDB-style file with coordinates for d1uwgl2.
(The format of our PDB-style files is described here.)

Timeline for d1uwgl2: