SCOP 1.73: Domain d1uwgh2: 1uwg H:114-215

Lineage for d1uwgh2 (1uwg H:114-215)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88575] (150 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)

8. Domain d1uwgh2: 1uwg H:114-215 [100116]
   Other proteins in same PDB: d1uwgh1, d1uwgl1, d1uwgl2, d1uwgx1, d1uwgx2, d1uwgy1

Details for d1uwgh2

PDB Entry: 1uwg, 2.79 Å

PDB Description: molecular mechanism of enantioselective proton transfer to carbon in catalytic antibody 14d9

PDB Compounds: (H:) antibody 14d9

SCOP Domain Sequences for d1uwgh2:

Sequence, based on SEQRES records:

>d1uwgh2 b.1.1.2 (H:114-215) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepks

Sequence, based on observed residues (ATOM records):

>d1uwgh2 b.1.1.2 (H:114-215) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplaptaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslssv
vtvpssslgtqtyicnvnhkpsntkvdkkvepks

Timeline for d1uwgh2:

• d1uwgh2 first appeared in SCOP 1.67
  
• d1uwgh2 appears in SCOP 1.71
  
• d1uwgh2 appears in SCOP 1.75
  
• d1uwgh2 appears in the current release, SCOPe 2.08