Lineage for d1uwgh2 (1uwg H:114-215)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 548299Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 549023Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 549027Species Human (Homo sapiens) [TaxId:9606] [88575] (105 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
  8. 549130Domain d1uwgh2: 1uwg H:114-215 [100116]
    Other proteins in same PDB: d1uwgh1, d1uwgl1, d1uwgl2, d1uwgx1, d1uwgx2, d1uwgy1

Details for d1uwgh2

PDB Entry: 1uwg (more details), 2.79 Å

PDB Description: molecular mechanism of enantioselective proton transfer to carbon in catalytic antibody 14d9

SCOP Domain Sequences for d1uwgh2:

Sequence, based on SEQRES records: (download)

>d1uwgh2 b.1.1.2 (H:114-215) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens)}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepks

Sequence, based on observed residues (ATOM records): (download)

>d1uwgh2 b.1.1.2 (H:114-215) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens)}
astkgpsvfplaptaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslssv
vtvpssslgtqtyicnvnhkpsntkvdkkvepks

SCOP Domain Coordinates for d1uwgh2:

Click to download the PDB-style file with coordinates for d1uwgh2.
(The format of our PDB-style files is described here.)

Timeline for d1uwgh2: