SCOP 1.75: Domain d1uwex2: 1uwe X:108-212

Lineage for d1uwex2 (1uwe X:108-212)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88569] (132 PDB entries)
   SQ NA # humanized antibody
   Uniprot P01834 # KAC_HUMAN Ig kappa chain C region
   SQ P01834 # KAC_HUMAN Ig kappa chain C region.
   SQ NA # engineered antibody
   including humanized antibodies (chimeric proteins with human constant domains)
   SQ NA # humanized antibody ! Uniprot P01834 # KAC_HUMAN Ig kappa chain C region ! SQ P01834 # KAC_HUMAN Ig kappa chain C region. ! SQ NA # engineered antibody

8. Domain d1uwex2: 1uwe X:108-212 [100112]
   Other proteins in same PDB: d1uweh1, d1uweh2, d1uwel1, d1uweu1, d1uwev1, d1uwev2, d1uwex1, d1uwey1, d1uwey2
   part of catalytic Fab 14d9

Details for d1uwex2

PDB Entry: 1uwe, 2.67 Å

PDB Description: molecular mechanism of enantioselective proton transfer to carbon in catalytic antibody 14d9

PDB Compounds: (X:) antibody 14d9

SCOP Domain Sequences for d1uwex2:

Sequence; same for both SEQRES and ATOM records:

>d1uwex2 b.1.1.2 (X:108-212) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsaeqlasgtasvvcllnnfypreaavqwkvdnalqsgnsqesvteqd
sadstyslsstltlskadyeahavyacevthqglsspvtksfnrg

Timeline for d1uwex2:

• d1uwex2 first appeared in SCOP 1.67
  
• d1uwex2 appears in SCOP 1.73
  
• d1uwex2 appears in SCOPe 2.01
  
• d1uwex2 appears in the current release, SCOPe 2.08