Lineage for d1uwev2 (1uwe V:114-216)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 364354Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 365019Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 365023Species Human (Homo sapiens) [TaxId:9606] [88575] (78 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
  8. 365105Domain d1uwev2: 1uwe V:114-216 [100110]
    Other proteins in same PDB: d1uweh1, d1uwel1, d1uwel2, d1uweu1, d1uweu2, d1uwev1, d1uwex1, d1uwex2, d1uwey1

Details for d1uwev2

PDB Entry: 1uwe (more details), 2.67 Å

PDB Description: molecular mechanism of enantioselective proton transfer to carbon in catalytic antibody 14d9

SCOP Domain Sequences for d1uwev2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uwev2 b.1.1.2 (V:114-216) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens)}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntavdkavepksc

SCOP Domain Coordinates for d1uwev2:

Click to download the PDB-style file with coordinates for d1uwev2.
(The format of our PDB-style files is described here.)

Timeline for d1uwev2: