SCOP 1.67: Domain d1uwev2: 1uwe V:114-216

Lineage for d1uwev2 (1uwe V:114-216)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88575] (78 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)

8. Domain d1uwev2: 1uwe V:114-216 [100110]
   Other proteins in same PDB: d1uweh1, d1uwel1, d1uwel2, d1uweu1, d1uweu2, d1uwev1, d1uwex1, d1uwex2, d1uwey1

Details for d1uwev2

PDB Entry: 1uwe, 2.67 Å

PDB Description: molecular mechanism of enantioselective proton transfer to carbon in catalytic antibody 14d9

SCOP Domain Sequences for d1uwev2:

Sequence; same for both SEQRES and ATOM records:

>d1uwev2 b.1.1.2 (V:114-216) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens)}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntavdkavepksc

Timeline for d1uwev2:

• d1uwev2 is new in SCOP 1.67
  
• d1uwev2 appears in SCOP 1.69
  
• d1uwev2 appears in the current release, SCOPe 2.08