Lineage for d1uwev1 (1uwe V:4-113)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 362617Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins)
  6. 362751Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 363037Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (141 PDB entries)
  8. 363177Domain d1uwev1: 1uwe V:4-113 [100109]
    Other proteins in same PDB: d1uweh2, d1uwel1, d1uwel2, d1uweu1, d1uweu2, d1uwev2, d1uwex1, d1uwex2, d1uwey2

Details for d1uwev1

PDB Entry: 1uwe (more details), 2.67 Å

PDB Description: molecular mechanism of enantioselective proton transfer to carbon in catalytic antibody 14d9

SCOP Domain Sequences for d1uwev1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uwev1 b.1.1.1 (V:4-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2}
llaqsgpelvkpgasvkiscaasaysitdftiywvkqshgdslewiggidphngggaynq
kfrvkatltvdtssstayihlnsltsedsavyycaifygnffdywgqgttvtvss

SCOP Domain Coordinates for d1uwev1:

Click to download the PDB-style file with coordinates for d1uwev1.
(The format of our PDB-style files is described here.)

Timeline for d1uwev1: