Class b: All beta proteins [48724] (165 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [88569] (125 PDB entries) including humanized antibodies (chimeric proteins with human constant domains) |
Domain d1uweu2: 1uwe U:108-212 [100108] Other proteins in same PDB: d1uweh1, d1uweh2, d1uwel1, d1uweu1, d1uwev1, d1uwev2, d1uwex1, d1uwey1, d1uwey2 |
PDB Entry: 1uwe (more details), 2.67 Å
SCOP Domain Sequences for d1uweu2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uweu2 b.1.1.2 (U:108-212) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]} rtvaapsvfifppsaeqlasgtasvvcllnnfypreaavqwkvdnalqsgnsqesvteqd sadstyslsstltlskadyeahavyacevthqglsspvtksfnrg
Timeline for d1uweu2: