Lineage for d1uweu1 (1uwe U:1-107)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2017117Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 protein domains)
  6. 2018294Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2018893Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (216 PDB entries)
    Uniprot P01645 1-106 # 95% sequense identity; KV5L_MOUSE Ig kappa chain V-V region HP 93G7 ! SQ NA # natural chimera; best hits are: Uniprot P01637 (Ig kappa chain V-V region T1) and Uniprot P01837 (Ig kappa chain C region) ! SQ NA # humanized antibody ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01642 21-115 # ! KV5I_MOUSE Ig kappa chain V-V region L7 precursor
  8. 2019091Domain d1uweu1: 1uwe U:1-107 [100107]
    Other proteins in same PDB: d1uweh1, d1uweh2, d1uwel2, d1uweu2, d1uwev1, d1uwev2, d1uwex2, d1uwey1, d1uwey2
    part of catalytic Fab 14d9

Details for d1uweu1

PDB Entry: 1uwe (more details), 2.67 Å

PDB Description: molecular mechanism of enantioselective proton transfer to carbon in catalytic antibody 14d9
PDB Compounds: (U:) antibody 14d9

SCOPe Domain Sequences for d1uweu1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uweu1 b.1.1.1 (U:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]}
ldnvmtqspsfmstsvgdrvsvtcaasqnvgtnvawyqqkpgqppkaliystsyrysgvp
drftgsgsgtdftltisnvnsedlaeyfcqqyniypvtfgggtkleik

SCOPe Domain Coordinates for d1uweu1:

Click to download the PDB-style file with coordinates for d1uweu1.
(The format of our PDB-style files is described here.)

Timeline for d1uweu1: