SCOP 1.67: Domain d1uwcb_: 1uwc B:

Lineage for d1uwcb_ (1uwc B:)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (30 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.17: Fungal lipases [53558] (3 proteins)

6. Protein Feruloyl esterase A [102631] (1 species)
   Triacylglycerol lipase homologue

7. Species Aspergillus niger [102632] (2 PDB entries)

8. Domain d1uwcb_: 1uwc B: [100102]
   complexed with fer, nag, so4

Details for d1uwcb_

PDB Entry: 1uwc, 1.08 Å

PDB Description: feruloyl esterase from aspergillus niger

SCOP Domain Sequences for d1uwcb_:

Sequence; same for both SEQRES and ATOM records:

>d1uwcb_ c.69.1.17 (B:) Feruloyl esterase A {Aspergillus niger}
astqgisedlynrlvematisqaayadlcnipstiikgekiynaqtdingwilrddtske
iitvfrgtgsdtnlqldtnytltpfdtlpqcndcevhggyyigwisvqdqveslvkqqas
qypdyaltvtghslgasmaaltaaqlsatydnvrlytfgeprsgnqafasymndafqvss
pettqyfrvthsndgipnlppaeqgyahggveywsvdpysaqntfvctgdevqcceaqgg
qgvndahttyfgmtsgactwv

Timeline for d1uwcb_:

• d1uwcb_ is new in SCOP 1.67
  
• d1uwcb_ appears in SCOP 1.69
  
• d1uwcb_ appears in the current release, SCOPe 2.08, called d1uwcb1