Lineage for d1uw8a_ (1uw8 A:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 470565Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 470566Superfamily b.82.1: RmlC-like cupins [51182] (13 families) (S)
  5. 470598Family b.82.1.2: Germin/Seed storage 7S protein [51187] (4 proteins)
  6. 470612Protein Oxalate decarboxylase OxdC (YvrK) [75033] (1 species)
    duplication: consists of two germin-like metal-ion binding domains
  7. 470613Species Bacillus subtilis [TaxId:1423] [75034] (3 PDB entries)
  8. 470615Domain d1uw8a_: 1uw8 A: [100100]

Details for d1uw8a_

PDB Entry: 1uw8 (more details), 2 Å

PDB Description: crystal structure of oxalate decarboxylase

SCOP Domain Sequences for d1uw8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uw8a_ b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {Bacillus subtilis}
dipqpirgdkgatvkiprnierdrqnpdmlvppetdhgtvsnmkfsfsdthnrlekggya
revtvrelpisenlasvnmrlkpgairelhwhkeaewaymiygsarvtivdekgrsfidd
vgegdlwyfpsglphsiqaleegaefllvfddgsfsenstfqltdwlahtpkeviaanfg
vtkeeisnlpgkekyifenqlpgslkddivegpngevpypftyrlleqepieseggkvyi
adstnfkvsktiasalvtvepgamrelhwhpnthewqyyisgkarmtvfasdghartfny
qagdvgyvpfamghyvenigdeplvfleifkddhyadvslnqwlamlpetfvqahldlgk
dftdvlskekhpvvkkk

SCOP Domain Coordinates for d1uw8a_:

Click to download the PDB-style file with coordinates for d1uw8a_.
(The format of our PDB-style files is described here.)

Timeline for d1uw8a_: