![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.140: Replicase NSP9 [101815] (1 superfamily) barrel; n=6, S=8, greek-key; similar to one trypsin-like protease barrel |
![]() | Superfamily b.140.1: Replicase NSP9 [101816] (2 families) ![]() |
![]() | Family b.140.1.1: Replicase NSP9 [101817] (2 proteins) automatically mapped to Pfam PF08710 |
![]() | Protein Replicase NSP9 [101818] (1 species) part of polyprotein 1AB; binds ssRNA |
![]() | Species SARS coronavirus [TaxId:227859] [101819] (2 PDB entries) |
![]() | Domain d1uw7a1: 1uw7 A:1-113 [100099] Other proteins in same PDB: d1uw7a2 |
PDB Entry: 1uw7 (more details), 2.8 Å
SCOPe Domain Sequences for d1uw7a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uw7a1 b.140.1.1 (A:1-113) Replicase NSP9 {SARS coronavirus [TaxId: 227859]} nnelspvalrqmscaagttqtactddnalayynnskggrfvlallsdhqdlkwarfpksd gtgtiyteleppcrfvtdtpkgpkvkylyfikglnnlnrgmvlgslaatvrlq
Timeline for d1uw7a1: