Lineage for d1uw7a1 (1uw7 A:1-113)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2824768Fold b.140: Replicase NSP9 [101815] (1 superfamily)
    barrel; n=6, S=8, greek-key; similar to one trypsin-like protease barrel
  4. 2824769Superfamily b.140.1: Replicase NSP9 [101816] (2 families) (S)
  5. 2824770Family b.140.1.1: Replicase NSP9 [101817] (2 proteins)
    automatically mapped to Pfam PF08710
  6. 2824771Protein Replicase NSP9 [101818] (1 species)
    part of polyprotein 1AB; binds ssRNA
  7. 2824772Species SARS coronavirus [TaxId:227859] [101819] (2 PDB entries)
  8. 2824775Domain d1uw7a1: 1uw7 A:1-113 [100099]
    Other proteins in same PDB: d1uw7a2

Details for d1uw7a1

PDB Entry: 1uw7 (more details), 2.8 Å

PDB Description: nsp9 protein from sars-coronavirus.
PDB Compounds: (A:) nsp9

SCOPe Domain Sequences for d1uw7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uw7a1 b.140.1.1 (A:1-113) Replicase NSP9 {SARS coronavirus [TaxId: 227859]}
nnelspvalrqmscaagttqtactddnalayynnskggrfvlallsdhqdlkwarfpksd
gtgtiyteleppcrfvtdtpkgpkvkylyfikglnnlnrgmvlgslaatvrlq

SCOPe Domain Coordinates for d1uw7a1:

Click to download the PDB-style file with coordinates for d1uw7a1.
(The format of our PDB-style files is described here.)

Timeline for d1uw7a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1uw7a2