SCOPe 2.08: Domain d1uw7a1: 1uw7 A:1-113

Lineage for d1uw7a1 (1uw7 A:1-113)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.140: Replicase NSP9 [101815] (1 superfamily)
   barrel; n=6, S=8, greek-key; similar to one trypsin-like protease barrel

4. Superfamily b.140.1: Replicase NSP9 [101816] (2 families)

5. Family b.140.1.1: Replicase NSP9 [101817] (2 proteins)
   automatically mapped to Pfam PF08710

6. Protein Replicase NSP9 [101818] (1 species)
   part of polyprotein 1AB; binds ssRNA

7. Species SARS coronavirus [TaxId:227859] [101819] (2 PDB entries)

8. Domain d1uw7a1: 1uw7 A:1-113 [100099]
   Other proteins in same PDB: d1uw7a2

Details for d1uw7a1

PDB Entry: 1uw7, 2.8 Å

PDB Description: nsp9 protein from sars-coronavirus.

PDB Compounds: (A:) nsp9

SCOPe Domain Sequences for d1uw7a1:

Sequence; same for both SEQRES and ATOM records:

>d1uw7a1 b.140.1.1 (A:1-113) Replicase NSP9 {SARS coronavirus [TaxId: 227859]}
nnelspvalrqmscaagttqtactddnalayynnskggrfvlallsdhqdlkwarfpksd
gtgtiyteleppcrfvtdtpkgpkvkylyfikglnnlnrgmvlgslaatvrlq

Timeline for d1uw7a1:

• d1uw7a1 first appeared in SCOP 1.67, called d1uw7a_
  
• d1uw7a1 appears in SCOPe 2.07