![]() | Class b: All beta proteins [48724] (149 folds) |
![]() | Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds |
![]() | Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (1 family) ![]() |
![]() | Family b.96.1.1: Nicotinic receptor ligand binding domain-like [63713] (1 protein) |
![]() | Protein Acetylcholine binding protein (ACHBP) [63714] (1 species) |
![]() | Species Great pond snail (Lymnaea stagnalis) [TaxId:6523] [63715] (4 PDB entries) |
![]() | Domain d1uw6t_: 1uw6 T: [100098] complexed with nct |
PDB Entry: 1uw6 (more details), 2.2 Å
SCOP Domain Sequences for d1uw6t_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uw6t_ b.96.1.1 (T:) Acetylcholine binding protein (ACHBP) {Great pond snail (Lymnaea stagnalis)} efdradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttws drtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirq rfscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqk knsvtysccpeayedvevslnfrkkgrs
Timeline for d1uw6t_: