![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds |
![]() | Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) ![]() |
![]() | Family b.96.1.1: Nicotinic receptor ligand binding domain-like [63713] (2 proteins) automatically mapped to Pfam PF02931 |
![]() | Protein Acetylcholine binding protein (ACHBP) [63714] (1 species) |
![]() | Species Great pond snail (Lymnaea stagnalis) [TaxId:6523] [63715] (9 PDB entries) |
![]() | Domain d1uw6p_: 1uw6 P: [100094] complexed with nct |
PDB Entry: 1uw6 (more details), 2.2 Å
SCOPe Domain Sequences for d1uw6p_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uw6p_ b.96.1.1 (P:) Acetylcholine binding protein (ACHBP) {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]} efdradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttws drtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirq rfscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqk knsvtysccpeayedvevslnfrkkg
Timeline for d1uw6p_: