Lineage for d1uw6h_ (1uw6 H:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 568729Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 568730Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (1 family) (S)
  5. 568731Family b.96.1.1: Nicotinic receptor ligand binding domain-like [63713] (1 protein)
  6. 568732Protein Acetylcholine binding protein (ACHBP) [63714] (1 species)
  7. 568733Species Great pond snail (Lymnaea stagnalis) [TaxId:6523] [63715] (4 PDB entries)
  8. 568741Domain d1uw6h_: 1uw6 H: [100086]

Details for d1uw6h_

PDB Entry: 1uw6 (more details), 2.2 Å

PDB Description: x-ray structure of acetylcholine binding protein (achbp) in complex with nicotine

SCOP Domain Sequences for d1uw6h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uw6h_ b.96.1.1 (H:) Acetylcholine binding protein (ACHBP) {Great pond snail (Lymnaea stagnalis)}
efdradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttws
drtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirq
rfscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqk
knsvtysccpeayedvevslnfrkkg

SCOP Domain Coordinates for d1uw6h_:

Click to download the PDB-style file with coordinates for d1uw6h_.
(The format of our PDB-style files is described here.)

Timeline for d1uw6h_: