Lineage for d1uw6c_ (1uw6 C:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1561825Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 1561826Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. 1561827Family b.96.1.1: Nicotinic receptor ligand binding domain-like [63713] (2 proteins)
    automatically mapped to Pfam PF02931
  6. 1561828Protein Acetylcholine binding protein (ACHBP) [63714] (1 species)
  7. 1561829Species Great pond snail (Lymnaea stagnalis) [TaxId:6523] [63715] (8 PDB entries)
  8. 1561858Domain d1uw6c_: 1uw6 C: [100081]
    complexed with nct

Details for d1uw6c_

PDB Entry: 1uw6 (more details), 2.2 Å

PDB Description: x-ray structure of acetylcholine binding protein (achbp) in complex with nicotine
PDB Compounds: (C:) acetylcholine-binding protein

SCOPe Domain Sequences for d1uw6c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uw6c_ b.96.1.1 (C:) Acetylcholine binding protein (ACHBP) {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]}
efdradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttws
drtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirq
rfscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqk
knsvtysccpeayedvevslnfrkkg

SCOPe Domain Coordinates for d1uw6c_:

Click to download the PDB-style file with coordinates for d1uw6c_.
(The format of our PDB-style files is described here.)

Timeline for d1uw6c_: