Lineage for d1uw6c_ (1uw6 C:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 471913Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 471914Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (1 family) (S)
  5. 471915Family b.96.1.1: Nicotinic receptor ligand binding domain-like [63713] (1 protein)
  6. 471916Protein Acetylcholine binding protein (ACHBP) [63714] (1 species)
  7. 471917Species Great pond snail (Lymnaea stagnalis) [TaxId:6523] [63715] (4 PDB entries)
  8. 471940Domain d1uw6c_: 1uw6 C: [100081]

Details for d1uw6c_

PDB Entry: 1uw6 (more details), 2.2 Å

PDB Description: x-ray structure of acetylcholine binding protein (achbp) in complex with nicotine

SCOP Domain Sequences for d1uw6c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uw6c_ b.96.1.1 (C:) Acetylcholine binding protein (ACHBP) {Great pond snail (Lymnaea stagnalis)}
efdradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttws
drtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirq
rfscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqk
knsvtysccpeayedvevslnfrkkg

SCOP Domain Coordinates for d1uw6c_:

Click to download the PDB-style file with coordinates for d1uw6c_.
(The format of our PDB-style files is described here.)

Timeline for d1uw6c_: