Lineage for d1uw5b_ (1uw5 B:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 510905Fold d.129: TBP-like [55944] (8 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 511069Superfamily d.129.3: Bet v1-like [55961] (5 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 511133Family d.129.3.4: Phoshatidylinositol transfer protein, PITP [64388] (1 protein)
  6. 511134Protein Phoshatidylinositol transfer protein, PITP [64389] (3 species)
  7. 511135Species Human (Homo sapiens) [TaxId:9606] [103253] (1 PDB entry)
  8. 511137Domain d1uw5b_: 1uw5 B: [100076]

Details for d1uw5b_

PDB Entry: 1uw5 (more details), 2.9 Å

PDB Description: structure of pitp-alpha complexed to phosphatidylinositol

SCOP Domain Sequences for d1uw5b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uw5b_ d.129.3.4 (B:) Phoshatidylinositol transfer protein, PITP {Human (Homo sapiens)}
mvllkeyrvilpvsvdeyqvgqlysvaeasknetgggegvevlvnepyekdgekgqythk
iyhlqskvptfvrmlapegalnihekawnaypycrtvitneymkedflikietwhkpdlg
tqenvhklepeawkhveavyidiadrsqvlskdykaeedpakfksiktgrgplgpnwkqe
lvnqkdcpymcayklvtvkfkwwglqnkvenfihkqerrlftnfhrqlfcwldkwvdltm
ddirrmeeetkrqldemrqkdpvkgmtad

SCOP Domain Coordinates for d1uw5b_:

Click to download the PDB-style file with coordinates for d1uw5b_.
(The format of our PDB-style files is described here.)

Timeline for d1uw5b_: