![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
![]() | Superfamily d.129.3: Bet v1-like [55961] (11 families) ![]() contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix |
![]() | Family d.129.3.4: Phoshatidylinositol transfer protein, PITP [64388] (2 proteins) automatically mapped to Pfam PF02121 |
![]() | Protein Phoshatidylinositol transfer protein, PITP [64389] (4 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [103253] (1 PDB entry) |
![]() | Domain d1uw5b_: 1uw5 B: [100076] complexed to phosphatidylinositol complexed with pie |
PDB Entry: 1uw5 (more details), 2.9 Å
SCOPe Domain Sequences for d1uw5b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uw5b_ d.129.3.4 (B:) Phoshatidylinositol transfer protein, PITP {Human (Homo sapiens) [TaxId: 9606]} mvllkeyrvilpvsvdeyqvgqlysvaeasknetgggegvevlvnepyekdgekgqythk iyhlqskvptfvrmlapegalnihekawnaypycrtvitneymkedflikietwhkpdlg tqenvhklepeawkhveavyidiadrsqvlskdykaeedpakfksiktgrgplgpnwkqe lvnqkdcpymcayklvtvkfkwwglqnkvenfihkqerrlftnfhrqlfcwldkwvdltm ddirrmeeetkrqldemrqkdpvkgmtad
Timeline for d1uw5b_: