SCOP 1.67: Domain d1uw5a_: 1uw5 A:

Lineage for d1uw5a_ (1uw5 A:)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.129: TBP-like [55944] (7 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.3: Bet v1-like [55961] (4 families)
   contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix

5. Family d.129.3.4: Phoshatidylinositol transfer protein, PITP [64388] (1 protein)

6. Protein Phoshatidylinositol transfer protein, PITP [64389] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [103253] (1 PDB entry)

8. Domain d1uw5a_: 1uw5 A: [100075]

Details for d1uw5a_

PDB Entry: 1uw5, 2.9 Å

PDB Description: structure of pitp-alpha complexed to phosphatidylinositol

SCOP Domain Sequences for d1uw5a_:

Sequence; same for both SEQRES and ATOM records:

>d1uw5a_ d.129.3.4 (A:) Phoshatidylinositol transfer protein, PITP {Human (Homo sapiens)}
mvllkeyrvilpvsvdeyqvgqlysvaeasknetgggegvevlvnepyekdgekgqythk
iyhlqskvptfvrmlapegalnihekawnaypycrtvitneymkedflikietwhkpdlg
tqenvhklepeawkhveavyidiadrsqvlskdykaeedpakfksiktgrgplgpnwkqe
lvnqkdcpymcayklvtvkfkwwglqnkvenfihkqerrlftnfhrqlfcwldkwvdltm
ddirrmeeetkrqldemrqkdpvkgmtad

Timeline for d1uw5a_:

• d1uw5a_ is new in SCOP 1.67
  
• d1uw5a_ appears in SCOP 1.69
  
• d1uw5a_ appears in the current release, SCOPe 2.08