Lineage for d1uw5a_ (1uw5 A:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 418216Fold d.129: TBP-like [55944] (7 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 418378Superfamily d.129.3: Bet v1-like [55961] (4 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 418434Family d.129.3.4: Phoshatidylinositol transfer protein, PITP [64388] (1 protein)
  6. 418435Protein Phoshatidylinositol transfer protein, PITP [64389] (3 species)
  7. 418436Species Human (Homo sapiens) [TaxId:9606] [103253] (1 PDB entry)
  8. 418437Domain d1uw5a_: 1uw5 A: [100075]

Details for d1uw5a_

PDB Entry: 1uw5 (more details), 2.9 Å

PDB Description: structure of pitp-alpha complexed to phosphatidylinositol

SCOP Domain Sequences for d1uw5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uw5a_ d.129.3.4 (A:) Phoshatidylinositol transfer protein, PITP {Human (Homo sapiens)}
mvllkeyrvilpvsvdeyqvgqlysvaeasknetgggegvevlvnepyekdgekgqythk
iyhlqskvptfvrmlapegalnihekawnaypycrtvitneymkedflikietwhkpdlg
tqenvhklepeawkhveavyidiadrsqvlskdykaeedpakfksiktgrgplgpnwkqe
lvnqkdcpymcayklvtvkfkwwglqnkvenfihkqerrlftnfhrqlfcwldkwvdltm
ddirrmeeetkrqldemrqkdpvkgmtad

SCOP Domain Coordinates for d1uw5a_:

Click to download the PDB-style file with coordinates for d1uw5a_.
(The format of our PDB-style files is described here.)

Timeline for d1uw5a_: