Lineage for d1uw5a_ (1uw5 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2975208Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2975504Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 2975789Family d.129.3.4: Phoshatidylinositol transfer protein, PITP [64388] (2 proteins)
    automatically mapped to Pfam PF02121
  6. 2975790Protein Phoshatidylinositol transfer protein, PITP [64389] (4 species)
  7. 2975791Species Human (Homo sapiens) [TaxId:9606] [103253] (1 PDB entry)
  8. 2975792Domain d1uw5a_: 1uw5 A: [100075]
    complexed to phosphatidylinositol
    complexed with pie

Details for d1uw5a_

PDB Entry: 1uw5 (more details), 2.9 Å

PDB Description: structure of pitp-alpha complexed to phosphatidylinositol
PDB Compounds: (A:) Phosphatidylinositol transfer protein alpha isoform

SCOPe Domain Sequences for d1uw5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uw5a_ d.129.3.4 (A:) Phoshatidylinositol transfer protein, PITP {Human (Homo sapiens) [TaxId: 9606]}
mvllkeyrvilpvsvdeyqvgqlysvaeasknetgggegvevlvnepyekdgekgqythk
iyhlqskvptfvrmlapegalnihekawnaypycrtvitneymkedflikietwhkpdlg
tqenvhklepeawkhveavyidiadrsqvlskdykaeedpakfksiktgrgplgpnwkqe
lvnqkdcpymcayklvtvkfkwwglqnkvenfihkqerrlftnfhrqlfcwldkwvdltm
ddirrmeeetkrqldemrqkdpvkgmtad

SCOPe Domain Coordinates for d1uw5a_:

Click to download the PDB-style file with coordinates for d1uw5a_.
(The format of our PDB-style files is described here.)

Timeline for d1uw5a_: