Lineage for d1uw4d_ (1uw4 D:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2006337Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 2006716Family a.118.1.14: MIF4G domain-like [100908] (6 protein domains)
    duplication: family members contains 2 or more structurally similar domains of this fold connected by unstructured linkers
  6. 2006761Protein Regulator of nonsense transcripts 2, UPF2 [101405] (1 species)
  7. 2006762Species Human (Homo sapiens) [TaxId:9606] [101406] (1 PDB entry)
  8. 2006764Domain d1uw4d_: 1uw4 D: [100074]
    Other proteins in same PDB: d1uw4a_, d1uw4c_
    complexed with bme

Details for d1uw4d_

PDB Entry: 1uw4 (more details), 1.95 Å

PDB Description: the structural basis of the interaction between nonsense mediated decay factors upf2 and upf3
PDB Compounds: (D:) regulator of nonsense transcripts 2

SCOPe Domain Sequences for d1uw4d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uw4d_ a.118.1.14 (D:) Regulator of nonsense transcripts 2, UPF2 {Human (Homo sapiens) [TaxId: 9606]}
rpplqeyvrkllykdlskvttekvlrqmrklpwqdqevkdyviccminiwnvkynsihcv
anllaglvlyqedvgihvvdgvledirlgmevnqpkfnqrrissakflgelynyrmvesa
vifrtlysftsfgvnpdgspssldppehlfrirlvctildtcgqyfdrgsskrkldcflv
yfqryvwwkkslevwtkdhpfpididymisdtlellrpkiklcnsleesirqvqdleref
liklglvn

SCOPe Domain Coordinates for d1uw4d_:

Click to download the PDB-style file with coordinates for d1uw4d_.
(The format of our PDB-style files is described here.)

Timeline for d1uw4d_: