Lineage for d1uw4c_ (1uw4 C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951860Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) (S)
  5. 2952459Family d.58.7.4: Smg-4/UPF3 [102987] (2 proteins)
    Pfam PF03467
  6. 2952460Protein RNA processing protein UPF3x, RRM domain [102988] (1 species)
  7. 2952461Species Human (Homo sapiens) [TaxId:9606] [102989] (1 PDB entry)
  8. 2952463Domain d1uw4c_: 1uw4 C: [100073]
    Other proteins in same PDB: d1uw4b_, d1uw4d_
    complexed with bme

Details for d1uw4c_

PDB Entry: 1uw4 (more details), 1.95 Å

PDB Description: the structural basis of the interaction between nonsense mediated decay factors upf2 and upf3
PDB Compounds: (C:) upf3x

SCOPe Domain Sequences for d1uw4c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uw4c_ d.58.7.4 (C:) RNA processing protein UPF3x, RRM domain {Human (Homo sapiens) [TaxId: 9606]}
lskvvirrlpptltkeqlqehlqpmpehdyfeffsndtslyphmyarayinfknqediil
frdrfdgyvfldnkgqeypaivefapfqkaa

SCOPe Domain Coordinates for d1uw4c_:

Click to download the PDB-style file with coordinates for d1uw4c_.
(The format of our PDB-style files is described here.)

Timeline for d1uw4c_: