![]() | Class a: All alpha proteins [46456] (285 folds) |
![]() | Superfamily a.118.1: ARM repeat [48371] (26 families) ![]() |
![]() | Family a.118.1.14: MIF4G domain-like [100908] (6 proteins) duplication: family members contains 2 or more structurally similar domains of this fold connected by unstructured linkers this is a repeat family; one repeat unit is 1hu3 A:905-942 found in domain |
![]() | Protein Regulator of nonsense transcripts 2, UPF2 [101405] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [101406] (1 PDB entry) |
![]() | Domain d1uw4b_: 1uw4 B: [100072] Other proteins in same PDB: d1uw4a_, d1uw4c_ complexed with bme |
PDB Entry: 1uw4 (more details), 1.95 Å
SCOPe Domain Sequences for d1uw4b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uw4b_ a.118.1.14 (B:) Regulator of nonsense transcripts 2, UPF2 {Human (Homo sapiens) [TaxId: 9606]} rpplqeyvrkllykdlskvttekvlrqmrklpwqdqevkdyviccminiwnvkynsihcv anllaglvlyqedvgihvvdgvledirlgmevnqpkfnqrrissakflgelynyrmvesa vifrtlysftsfgvnpdgspssldppehlfrirlvctildtcgqyfdrgsskrkldcflv yfqryvwwkkslevwtkdhpfpididymisdtlellrpkiklcnsleesirqvqdleref liklglvn
Timeline for d1uw4b_: