SCOP 1.67: Domain d1uw4b_: 1uw4 B:

Lineage for d1uw4b_ (1uw4 B:)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (20 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.1: ARM repeat [48371] (14 families)

5. Family a.118.1.14: MIF4G domain-like [100908] (4 proteins)
   duplication: family members contains 2 or more structurally similar domains of this fold connected by unstructured linkers
   this is a repeat family; one repeat unit is 1hu3 A:905-942 found in domain

6. Protein Regulator of nonsense transcripts 2, UPF2 [101405] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101406] (1 PDB entry)

8. Domain d1uw4b_: 1uw4 B: [100072]
   Other proteins in same PDB: d1uw4a_, d1uw4c_

Details for d1uw4b_

PDB Entry: 1uw4, 1.95 Å

PDB Description: the structural basis of the interaction between nonsense mediated decay factors upf2 and upf3

SCOP Domain Sequences for d1uw4b_:

Sequence; same for both SEQRES and ATOM records:

>d1uw4b_ a.118.1.14 (B:) Regulator of nonsense transcripts 2, UPF2 {Human (Homo sapiens)}
rpplqeyvrkllykdlskvttekvlrqmrklpwqdqevkdyviccminiwnvkynsihcv
anllaglvlyqedvgihvvdgvledirlgmevnqpkfnqrrissakflgelynyrmvesa
vifrtlysftsfgvnpdgspssldppehlfrirlvctildtcgqyfdrgsskrkldcflv
yfqryvwwkkslevwtkdhpfpididymisdtlellrpkiklcnsleesirqvqdleref
liklglvn

Timeline for d1uw4b_:

• d1uw4b_ is new in SCOP 1.67
  
• d1uw4b_ appears in SCOP 1.69
  
• d1uw4b_ appears in the current release, SCOPe 2.08