SCOPe 2.04: Domain d1uw4a_: 1uw4 A:

Lineage for d1uw4a_ (1uw4 A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families)

5. Family d.58.7.4: Smg-4/UPF3 [102987] (2 proteins)
   Pfam PF03467

6. Protein RNA processing protein UPF3x, RRM domain [102988] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [102989] (1 PDB entry)

8. Domain d1uw4a_: 1uw4 A: [100071]
   Other proteins in same PDB: d1uw4b_, d1uw4d_
   complexed with bme

Details for d1uw4a_

PDB Entry: 1uw4, 1.95 Å

PDB Description: the structural basis of the interaction between nonsense mediated decay factors upf2 and upf3

PDB Compounds: (A:) upf3x

SCOPe Domain Sequences for d1uw4a_:

Sequence; same for both SEQRES and ATOM records:

>d1uw4a_ d.58.7.4 (A:) RNA processing protein UPF3x, RRM domain {Human (Homo sapiens) [TaxId: 9606]}
lskvvirrlpptltkeqlqehlqpmpehdyfeffsndtslyphmyarayinfknqediil
frdrfdgyvfldnkgqeypaivefapfqkaa

Timeline for d1uw4a_:

• d1uw4a_ first appeared in SCOP 1.67
  
• d1uw4a_ appears in SCOPe 2.03
  
• d1uw4a_ appears in SCOPe 2.05
  
• d1uw4a_ appears in the current release, SCOPe 2.08