Lineage for d1uw4a_ (1uw4 A:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 411877Fold d.58: Ferredoxin-like [54861] (48 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 412350Superfamily d.58.7: RNA-binding domain, RBD [54928] (4 families) (S)
  5. 412518Family d.58.7.4: Smg-4/UPF3 [102987] (1 protein)
    Pfam 03467
  6. 412519Protein RNA processing protein UPF3x, RRM domain [102988] (1 species)
  7. 412520Species Human (Homo sapiens) [TaxId:9606] [102989] (1 PDB entry)
  8. 412521Domain d1uw4a_: 1uw4 A: [100071]
    Other proteins in same PDB: d1uw4b_, d1uw4d_

Details for d1uw4a_

PDB Entry: 1uw4 (more details), 1.95 Å

PDB Description: the structural basis of the interaction between nonsense mediated decay factors upf2 and upf3

SCOP Domain Sequences for d1uw4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uw4a_ d.58.7.4 (A:) RNA processing protein UPF3x, RRM domain {Human (Homo sapiens)}
lskvvirrlpptltkeqlqehlqpmpehdyfeffsndtslyphmyarayinfknqediil
frdrfdgyvfldnkgqeypaivefapfqkaa

SCOP Domain Coordinates for d1uw4a_:

Click to download the PDB-style file with coordinates for d1uw4a_.
(The format of our PDB-style files is described here.)

Timeline for d1uw4a_: