![]() | Class k: Designed proteins [58788] (41 folds) |
![]() | Fold k.42: In vitro evolution products [103779] (1 superfamily) |
![]() | Superfamily k.42.1: In vitro evolution products [103780] (1 family) ![]() |
![]() | Family k.42.1.1: Function-directed selections [103781] (1 protein) |
![]() | Protein Artificial nucleotide binding protein (ANBP) [103782] (1 species) binds ADP; contains zinc-binding site similar to that of the transcription factor GATA-1 |
![]() | Species Synthetic [103783] (1 PDB entry) |
![]() | Domain d1uw1a_: 1uw1 A: [100069] |
PDB Entry: 1uw1 (more details), 1.94 Å
SCOP Domain Sequences for d1uw1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uw1a_ k.42.1.1 (A:) Artificial nucleotide binding protein (ANBP) {Synthetic} ddkktnwlkriyrvrpcvkckvaprnwkvknkhlriynmcktcfnnsidigddtyhghdd wlmyads
Timeline for d1uw1a_: