Lineage for d1uw1a_ (1uw1 A:)

  1. Root: SCOPe 2.08
  2. 3047812Class k: Designed proteins [58788] (44 folds)
  3. 3048412Fold k.42: In vitro evolution products [103779] (1 superfamily)
  4. 3048413Superfamily k.42.1: In vitro evolution products [103780] (1 family) (S)
  5. 3048414Family k.42.1.1: Function-directed selections [103781] (1 protein)
  6. 3048415Protein Artificial nucleotide binding protein (ANBP) [103782] (1 species)
    binds ADP; contains zinc-binding site similar to that of the transcription factor GATA-1
  7. 3048416Species Synthetic [103783] (1 PDB entry)
  8. 3048417Domain d1uw1a_: 1uw1 A: [100069]
    complexed with adp, zn

Details for d1uw1a_

PDB Entry: 1uw1 (more details), 1.94 Å

PDB Description: a novel adp- and zinc-binding fold from function-directed in vitro evolution
PDB Compounds: (A:) artificial nucleotide binding protein (anbp)

SCOPe Domain Sequences for d1uw1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uw1a_ k.42.1.1 (A:) Artificial nucleotide binding protein (ANBP) {Synthetic}
ddkktnwlkriyrvrpcvkckvaprnwkvknkhlriynmcktcfnnsidigddtyhghdd
wlmyads

SCOPe Domain Coordinates for d1uw1a_:

Click to download the PDB-style file with coordinates for d1uw1a_.
(The format of our PDB-style files is described here.)

Timeline for d1uw1a_: