| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
| Family a.1.1.1: Truncated hemoglobin [46459] (2 proteins) lack the first helix (A) |
| Protein Protozoan/bacterial hemoglobin [46460] (6 species) |
| Species Green alga (Chlamydomonas eugametos) [TaxId:3054] [46462] (2 PDB entries) Globin li637 |
| Domain d1uvxa_: 1uvx A: [100067] complexed with cyn, hem, xe |
PDB Entry: 1uvx (more details), 2.45 Å
SCOPe Domain Sequences for d1uvxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uvxa_ a.1.1.1 (A:) Protozoan/bacterial hemoglobin {Green alga (Chlamydomonas eugametos) [TaxId: 3054]}
slfaklggreaveaavdkfynkivadptvstyfsntdmkvqrskqfaflayalggasewk
gkdmrtahkdlvphlsdvhfqavarhlsdtltelgvppeditdamavvastrtevlnmpq
q
Timeline for d1uvxa_: