SCOPe 2.06: Domain d1uvqb2: 1uvq B:3-94

Lineage for d1uvqb2 (1uvq B:3-94)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)

7. Species Human (Homo sapiens), HLA-DQ6 [TaxId:9606] [102836] (1 PDB entry)

8. Domain d1uvqb2: 1uvq B:3-94 [100065]
   Other proteins in same PDB: d1uvqa1, d1uvqa2, d1uvqb1
   complexed with a hypocretin peptide
   complexed with acy, gly, nag, zn

Details for d1uvqb2

PDB Entry: 1uvq, 1.8 Å

PDB Description: crystal structure of hla-dq0602 in complex with a hypocretin peptide

PDB Compounds: (B:) hla class II histocompatibility antigen

SCOPe Domain Sequences for d1uvqb2:

Sequence; same for both SEQRES and ATOM records:

>d1uvqb2 d.19.1.1 (B:3-94) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DQ6 [TaxId: 9606]}
spedfvfqfkgmcyftngtervrlvtryiynreeyarfdsdvgvyravtpqgrpdaeywn
sqkevlegtraeldtvcrhnyevafrgilqrr

Timeline for d1uvqb2:

• d1uvqb2 first appeared in SCOP 1.67
  
• d1uvqb2 appears in SCOPe 2.05
  
• d1uvqb2 appears in SCOPe 2.07
  
• d1uvqb2 appears in the current release, SCOPe 2.08