Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (11 proteins) |
Protein Class II MHC beta chain, N-terminal domain [88819] (15 species) |
Species Human (Homo sapiens), HLA-DQ6 [TaxId:9606] [102836] (1 PDB entry) |
Domain d1uvqb2: 1uvq B:3-94 [100065] Other proteins in same PDB: d1uvqa1, d1uvqa2, d1uvqb1 complexed with a hypocretin peptide complexed with acy, bma, fuc, gly, nag, zn |
PDB Entry: 1uvq (more details), 1.8 Å
SCOP Domain Sequences for d1uvqb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uvqb2 d.19.1.1 (B:3-94) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DQ6} spedfvfqfkgmcyftngtervrlvtryiynreeyarfdsdvgvyravtpqgrpdaeywn sqkevlegtraeldtvcrhnyevafrgilqrr
Timeline for d1uvqb2: