Lineage for d1uvqb1 (1uvq B:95-191)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2020524Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2022117Protein Class II MHC beta chain, C-terminal domain [88625] (6 species)
  7. 2022120Species Human (Homo sapiens), HLA-DQ group [TaxId:9606] [88630] (3 PDB entries)
    probably orthologous to the mouse I-A group
  8. 2022121Domain d1uvqb1: 1uvq B:95-191 [100064]
    Other proteins in same PDB: d1uvqa1, d1uvqa2, d1uvqb2
    complexed with a hypocretin peptide
    complexed with acy, gly, nag, zn

Details for d1uvqb1

PDB Entry: 1uvq (more details), 1.8 Å

PDB Description: crystal structure of hla-dq0602 in complex with a hypocretin peptide
PDB Compounds: (B:) hla class II histocompatibility antigen

SCOPe Domain Sequences for d1uvqb1:

Sequence, based on SEQRES records: (download)

>d1uvqb1 b.1.1.2 (B:95-191) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DQ group [TaxId: 9606]}
veptvtispsrtealnhhnllvcsvtdfypgqikvrwfrndqeetagvvstplirngdwt
fqilvmlemtpqrgdvytchvehpslqspitvewraq

Sequence, based on observed residues (ATOM records): (download)

>d1uvqb1 b.1.1.2 (B:95-191) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DQ group [TaxId: 9606]}
veptvtispsnllvcsvtdfypgqikvrwfrndqeetagvvstplirngdwtfqilvmle
mtpqrgdvytchvehpslqspitvewraq

SCOPe Domain Coordinates for d1uvqb1:

Click to download the PDB-style file with coordinates for d1uvqb1.
(The format of our PDB-style files is described here.)

Timeline for d1uvqb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1uvqb2