![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein Class II MHC beta chain, C-terminal domain [88625] (6 species) |
![]() | Species Human (Homo sapiens), HLA-DQ group [TaxId:9606] [88630] (3 PDB entries) probably orthologous to the mouse I-A group |
![]() | Domain d1uvqb1: 1uvq B:95-191 [100064] Other proteins in same PDB: d1uvqa1, d1uvqa2, d1uvqb2 complexed with a hypocretin peptide complexed with acy, gly, nag, zn |
PDB Entry: 1uvq (more details), 1.8 Å
SCOPe Domain Sequences for d1uvqb1:
Sequence, based on SEQRES records: (download)
>d1uvqb1 b.1.1.2 (B:95-191) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DQ group [TaxId: 9606]} veptvtispsrtealnhhnllvcsvtdfypgqikvrwfrndqeetagvvstplirngdwt fqilvmlemtpqrgdvytchvehpslqspitvewraq
>d1uvqb1 b.1.1.2 (B:95-191) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DQ group [TaxId: 9606]} veptvtispsnllvcsvtdfypgqikvrwfrndqeetagvvstplirngdwtfqilvmle mtpqrgdvytchvehpslqspitvewraq
Timeline for d1uvqb1: