| Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
| Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
| Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
| Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species) |
| Species Human (Homo sapiens), HLA-DQ6 [TaxId:9606] [102834] (1 PDB entry) |
| Domain d1uvqa2: 1uvq A:2-84 [100063] Other proteins in same PDB: d1uvqa1, d1uvqb1, d1uvqb2 complexed with a hypocretin peptide complexed with acy, gly, nag, zn |
PDB Entry: 1uvq (more details), 1.8 Å
SCOPe Domain Sequences for d1uvqa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uvqa2 d.19.1.1 (A:2-84) Class II MHC alpha chain, N-terminal domain {Human (Homo sapiens), HLA-DQ6 [TaxId: 9606]}
divadhvascgvnlyqfygpsgqythefdgdeqfyvdlerketawrwpefskfggfdpqg
alrnmavakhnlnimikrynsta
Timeline for d1uvqa2: