Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species) |
Species Human (Homo sapiens), HLA-DQ group [TaxId:9606] [88623] (3 PDB entries) probably orthologous to the mouse I-A group |
Domain d1uvqa1: 1uvq A:85-183 [100062] Other proteins in same PDB: d1uvqa2, d1uvqb1, d1uvqb2 complexed with a hypocretin peptide complexed with acy, gly, nag, zn |
PDB Entry: 1uvq (more details), 1.8 Å
SCOPe Domain Sequences for d1uvqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uvqa1 b.1.1.2 (A:85-183) Class II MHC alpha chain, C-terminal domain {Human (Homo sapiens), HLA-DQ group [TaxId: 9606]} atnevpevtvfskspvtlgqpntliclvdnifppvvnitwlsngqsvtegvsetsflsks dhsffkisyltflpsadeiydckvehwgldqpllkhwep
Timeline for d1uvqa1: