SCOP 1.73: Domain d1uvqa1: 1uvq A:85-183

Lineage for d1uvqa1 (1uvq A:85-183)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species)

7. Species Human (Homo sapiens), HLA-DQ group [TaxId:9606] [88623] (3 PDB entries)
   probably orthologous to the mouse I-A group

8. Domain d1uvqa1: 1uvq A:85-183 [100062]
   Other proteins in same PDB: d1uvqa2, d1uvqb1, d1uvqb2
   complexed with a hypocretin peptide
   complexed with acy, bma, fuc, gly, nag, zn

Details for d1uvqa1

PDB Entry: 1uvq, 1.8 Å

PDB Description: crystal structure of hla-dq0602 in complex with a hypocretin peptide

PDB Compounds: (A:) hla class II histocompatibility antigen

SCOP Domain Sequences for d1uvqa1:

Sequence; same for both SEQRES and ATOM records:

>d1uvqa1 b.1.1.2 (A:85-183) Class II MHC alpha chain, C-terminal domain {Human (Homo sapiens), HLA-DQ group [TaxId: 9606]}
atnevpevtvfskspvtlgqpntliclvdnifppvvnitwlsngqsvtegvsetsflsks
dhsffkisyltflpsadeiydckvehwgldqpllkhwep

Timeline for d1uvqa1:

• d1uvqa1 first appeared in SCOP 1.67
  
• d1uvqa1 appears in SCOP 1.71
  
• d1uvqa1 appears in SCOP 1.75
  
• d1uvqa1 appears in the current release, SCOPe 2.08