Lineage for d1uvne_ (1uvn E:)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2622069Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 2622070Superfamily e.8.1: DNA/RNA polymerases [56672] (8 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 2623647Family e.8.1.6: dsRNA phage RNA-dependent RNA-polymerase [64480] (1 protein)
    automatically mapped to Pfam PF00680
  6. 2623648Protein dsRNA phage RNA-dependent RNA-polymerase [64481] (1 species)
  7. 2623649Species Bacteriophage PHI-6 [TaxId:10879] [64482] (15 PDB entries)
  8. 2623690Domain d1uvne_: 1uvn E: [100059]
    protein/RNA complex; complexed with ca, gtp, mn

Details for d1uvne_

PDB Entry: 1uvn (more details), 3 Å

PDB Description: the structural basis for rna specificity and ca2 inhibition of an rna- dependent rna polymerase phi6p2 ca2+ inhibition complex
PDB Compounds: (E:) RNA-dependent RNA polymerase

SCOPe Domain Sequences for d1uvne_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uvne_ e.8.1.6 (E:) dsRNA phage RNA-dependent RNA-polymerase {Bacteriophage PHI-6 [TaxId: 10879]}
prrapafplsdikaqmlfannikaqqaskrsfkegaietyegllsvdprflsfknelsry
ltdhfpanvdeygrvygngvrtnffgmrhmngfpmipatwplasnlkkradadladgpvs
erdnllfraavrlmfsdlepvplkirkgsstcipyfsndmgtkieiaeralekaeeagnl
mlqgkfddayqlhqmggayyvvyraqstdaitldpktgkfvskdrmvadfeyavtggeqg
slfaaskdasrlkeqygidvpdgffcerrrtamggpfalnapimavaqpvrnkiyskyay
tfhhttrlnkeekvkewslcvatdvsdhdtfwpgwlrdlicdellnmgyapwwvklfets
lklpvyvgapapeqghtllgdpsnpdlevglssgqgatdlmgtllmsitylvmqldhtap
hlnsrikdmpsacrfldsywqgheeirqisksddamlgwtkgralvgghrlfemlkegkv
npspymkisyehggaflgdillydsrrepgsaifvgninsmlnnqfspeygvqsgvrdrs
krkrpfpglawasmkdtygacpiysdvleaiercwwnafgesyrayredmlkrdtlelsr
yvasmarqaglaeltpidlevladpnklqykwteadvsanihevlmhgvsvekterflrs
vmpr

SCOPe Domain Coordinates for d1uvne_:

Click to download the PDB-style file with coordinates for d1uvne_.
(The format of our PDB-style files is described here.)

Timeline for d1uvne_: