Lineage for d1uvla_ (1uvl A:)

  1. Root: SCOP 1.67
  2. 423625Class e: Multi-domain proteins (alpha and beta) [56572] (40 folds)
  3. 424451Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 424452Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 424777Family e.8.1.6: dsRNA phage RNA-dependent RNA-polymerase [64480] (1 protein)
  6. 424778Protein dsRNA phage RNA-dependent RNA-polymerase [64481] (1 species)
  7. 424779Species Bacteriophage PHI-6 [TaxId:10879] [64482] (11 PDB entries)
  8. 424792Domain d1uvla_: 1uvl A: [100051]

Details for d1uvla_

PDB Entry: 1uvl (more details), 2 Å

PDB Description: the structural basis for rna specificity and ca2 inhibition of an rna- dependent rna polymerase phi6p2 with 5nt rna. conformation b

SCOP Domain Sequences for d1uvla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uvla_ e.8.1.6 (A:) dsRNA phage RNA-dependent RNA-polymerase {Bacteriophage PHI-6}
prrapafplsdikaqmlfannikaqqaskrsfkegaietyegllsvdprflsfknelsry
ltdhfpanvdeygrvygngvrtnffgmrhmngfpmipatwplasnlkkradadladgpvs
erdnllfraavrlmfsdlepvplkirkgsstcipyfsndmgtkieiaeralekaeeagnl
mlqgkfddayqlhqmggayyvvyraqstdaitldpktgkfvskdrmvadfeyavtggeqg
slfaaskdasrlkeqygidvpdgffcerrrtamggpfalnapimavaqpvrnkiyskyay
tfhhttrlnkeekvkewslcvatdvsdhdtfwpgwlrdlicdellnmgyapwwvklfets
lklpvyvgapapeqghtllgdpsnpdlevglssgqgatdlmgtllmsitylvmqldhtap
hlnsrikdmpsacrfldsywqgheeirqisksddamlgwtkgralvgghrlfemlkegkv
npspymkisyehggaflgdillydsrrepgsaifvgninsmlnnqfspeygvqsgvrdrs
krkrpfpglawasmkdtygacpiysdvleaiercwwnafgesyrayredmlkrdtlelsr
yvasmarqaglaeltpidlevladpnklqykwteadvsanihevlmhgvsvekterflrs
vmpr

SCOP Domain Coordinates for d1uvla_:

Click to download the PDB-style file with coordinates for d1uvla_.
(The format of our PDB-style files is described here.)

Timeline for d1uvla_: