Lineage for d1uvia_ (1uvi A:)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2622069Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 2622070Superfamily e.8.1: DNA/RNA polymerases [56672] (8 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 2623647Family e.8.1.6: dsRNA phage RNA-dependent RNA-polymerase [64480] (1 protein)
    automatically mapped to Pfam PF00680
  6. 2623648Protein dsRNA phage RNA-dependent RNA-polymerase [64481] (1 species)
  7. 2623649Species Bacteriophage PHI-6 [TaxId:10879] [64482] (15 PDB entries)
  8. 2623659Domain d1uvia_: 1uvi A: [100042]
    protein/RNA complex; complexed with mn

Details for d1uvia_

PDB Entry: 1uvi (more details), 2.15 Å

PDB Description: the structural basis for rna specificity and ca2 inhibition of an rna- dependent rna polymerase phi6p2 with 6nt rna
PDB Compounds: (A:) RNA-dependent RNA polymerase

SCOPe Domain Sequences for d1uvia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uvia_ e.8.1.6 (A:) dsRNA phage RNA-dependent RNA-polymerase {Bacteriophage PHI-6 [TaxId: 10879]}
prrapafplsdikaqmlfannikaqqaskrsfkegaietyegllsvdprflsfknelsry
ltdhfpanvdeygrvygngvrtnffgmrhmngfpmipatwplasnlkkradadladgpvs
erdnllfraavrlmfsdlepvplkirkgsstcipyfsndmgtkieiaeralekaeeagnl
mlqgkfddayqlhqmggayyvvyraqstdaitldpktgkfvskdrmvadfeyavtggeqg
slfaaskdasrlkeqygidvpdgffcerrrtamggpfalnapimavaqpvrnkiyskyay
tfhhttrlnkeekvkewslcvatdvsdhdtfwpgwlrdlicdellnmgyapwwvklfets
lklpvyvgapapeqghtllgdpsnpdlevglssgqgatdlmgtllmsitylvmqldhtap
hlnsrikdmpsacrfldsywqgheeirqisksddamlgwtkgralvgghrlfemlkegkv
npspymkisyehggaflgdillydsrrepgsaifvgninsmlnnqfspeygvqsgvrdrs
krkrpfpglawasmkdtygacpiysdvleaiercwwnafgesyrayredmlkrdtlelsr
yvasmarqaglaeltpidlevladpnklqykwteadvsanihevlmhgvsvekterflrs
vmpr

SCOPe Domain Coordinates for d1uvia_:

Click to download the PDB-style file with coordinates for d1uvia_.
(The format of our PDB-style files is described here.)

Timeline for d1uvia_: