SCOPe 2.07: Domain d1uv7b_: 1uv7 B:

Lineage for d1uv7b_ (1uv7 B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.67: RRF/tRNA synthetase additional domain-like [55185] (4 superfamilies)
   core: alpha-beta(2)-alpha-beta(2); 2 layers: alpha/beta

4. Superfamily d.67.4: General secretion pathway protein M, EpsM [103054] (1 family)
   automatically mapped to Pfam PF04612

5. Family d.67.4.1: General secretion pathway protein M, EpsM [103055] (1 protein)

6. Protein General secretion pathway protein M, EpsM [103056] (1 species)

7. Species Vibrio cholerae [TaxId:666] [103057] (1 PDB entry)

8. Domain d1uv7b_: 1uv7 B: [100041]

Details for d1uv7b_

PDB Entry: 1uv7, 1.7 Å

PDB Description: periplasmic domain of epsm from vibrio cholerae

PDB Compounds: (B:) general secretion pathway protein m

SCOPe Domain Sequences for d1uv7b_:

Sequence, based on SEQRES records:

>d1uv7b_ d.67.4.1 (B:) General secretion pathway protein M, EpsM {Vibrio cholerae [TaxId: 666]}
qplnqvitnstrqfnielirvqprgemmqvwiqplpfsqlvswiaylqerqgvsvdaidi
drgkvngvvevkrlqlkr

Sequence, based on observed residues (ATOM records):

>d1uv7b_ d.67.4.1 (B:) General secretion pathway protein M, EpsM {Vibrio cholerae [TaxId: 666]}
qplnqvitnstrqfnielirvqprgemmqvwiqplpfsqlvswiaylqerqgvsvdaidi
drgvvevkrlqlkr

Timeline for d1uv7b_:

• d1uv7b_ first appeared in SCOP 1.67
  
• d1uv7b_ appears in SCOPe 2.06
  
• d1uv7b_ appears in the current release, SCOPe 2.08