Lineage for d1uv7b_ (1uv7 B:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 505899Fold d.67: RRF/tRNA synthetase additional domain-like [55185] (4 superfamilies)
    core: alpha-beta(2)-alpha-beta(2); 2 layers: alpha/beta
  4. 505938Superfamily d.67.4: General secretion pathway protein M, EpsM [103054] (1 family) (S)
  5. 505939Family d.67.4.1: General secretion pathway protein M, EpsM [103055] (1 protein)
  6. 505940Protein General secretion pathway protein M, EpsM [103056] (1 species)
  7. 505941Species Vibrio cholerae [TaxId:666] [103057] (1 PDB entry)
  8. 505943Domain d1uv7b_: 1uv7 B: [100041]

Details for d1uv7b_

PDB Entry: 1uv7 (more details), 1.7 Å

PDB Description: periplasmic domain of epsm from vibrio cholerae

SCOP Domain Sequences for d1uv7b_:

Sequence, based on SEQRES records: (download)

>d1uv7b_ d.67.4.1 (B:) General secretion pathway protein M, EpsM {Vibrio cholerae}
qplnqvitnstrqfnielirvqprgemmqvwiqplpfsqlvswiaylqerqgvsvdaidi
drgkvngvvevkrlqlkr

Sequence, based on observed residues (ATOM records): (download)

>d1uv7b_ d.67.4.1 (B:) General secretion pathway protein M, EpsM {Vibrio cholerae}
qplnqvitnstrqfnielirvqprgemmqvwiqplpfsqlvswiaylqerqgvsvdaidi
drgvvevkrlqlkr

SCOP Domain Coordinates for d1uv7b_:

Click to download the PDB-style file with coordinates for d1uv7b_.
(The format of our PDB-style files is described here.)

Timeline for d1uv7b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1uv7a_