![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.67: RRF/tRNA synthetase additional domain-like [55185] (4 superfamilies) core: alpha-beta(2)-alpha-beta(2); 2 layers: alpha/beta |
![]() | Superfamily d.67.4: General secretion pathway protein M, EpsM [103054] (1 family) ![]() automatically mapped to Pfam PF04612 |
![]() | Family d.67.4.1: General secretion pathway protein M, EpsM [103055] (1 protein) |
![]() | Protein General secretion pathway protein M, EpsM [103056] (1 species) |
![]() | Species Vibrio cholerae [TaxId:666] [103057] (1 PDB entry) |
![]() | Domain d1uv7a_: 1uv7 A: [100040] |
PDB Entry: 1uv7 (more details), 1.7 Å
SCOPe Domain Sequences for d1uv7a_:
Sequence, based on SEQRES records: (download)
>d1uv7a_ d.67.4.1 (A:) General secretion pathway protein M, EpsM {Vibrio cholerae [TaxId: 666]} qplnqvitnstrqfnielirvqprgemmqvwiqplpfsqlvswiaylqerqgvsvdaidi drgkvngvvevkrlqlkrgg
>d1uv7a_ d.67.4.1 (A:) General secretion pathway protein M, EpsM {Vibrio cholerae [TaxId: 666]} qplnqvitnstrqfnielirvqprgemmqvwiqplpfsqlvswiaylqerqgvsvdaidi drgvvevkrlqlkrgg
Timeline for d1uv7a_: