Lineage for d1uv5a_ (1uv5 A:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 419158Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 419159Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (6 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 419200Family d.144.1.7: Protein kinases, catalytic subunit [88854] (47 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 419489Protein Glycogen synthase kinase-3 beta (Gsk3b) [69823] (1 species)
    CMGC group; GSK3 subfamily; serine/threonine kinase
  7. 419490Species Human (Homo sapiens) [TaxId:9606] [69824] (12 PDB entries)
  8. 419508Domain d1uv5a_: 1uv5 A: [100029]
    complexed with brw, cl, co, po4

Details for d1uv5a_

PDB Entry: 1uv5 (more details), 2.8 Å

PDB Description: glycogen synthase kinase 3 beta complexed with 6-bromoindirubin-3'- oxime

SCOP Domain Sequences for d1uv5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uv5a_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens)}
skvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvaikkvlqgkafk
nrelqimrkldhcnivrlryffyssgekkdevylnlvldyvpetvyrvarhysrakqtlp
viyvklymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsakqlvrgepnv
syicsryyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdqlveiikvlg
tptreqiremnpnytefkfpqikahpwtkvfrprtppeaialcsrlleytptarltplea
cahsffdelrdpnvklpngrdtpalfnfttqelssnpplatilipphar

SCOP Domain Coordinates for d1uv5a_:

Click to download the PDB-style file with coordinates for d1uv5a_.
(The format of our PDB-style files is described here.)

Timeline for d1uv5a_: