Lineage for d1uv0a_ (1uv0 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3001353Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 3001354Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 3001355Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 3001665Protein Pancreatitis-associated protein 1 [103341] (1 species)
  7. 3001666Species Human (Homo sapiens) [TaxId:9606] [103342] (1 PDB entry)
  8. 3001667Domain d1uv0a_: 1uv0 A: [100028]
    complexed with zn

Details for d1uv0a_

PDB Entry: 1uv0 (more details), 1.78 Å

PDB Description: pancreatitis-associated protein 1 from human
PDB Compounds: (A:) pancreatitis-associated protein 1

SCOPe Domain Sequences for d1uv0a_:

Sequence, based on SEQRES records: (download)

>d1uv0a_ d.169.1.1 (A:) Pancreatitis-associated protein 1 {Human (Homo sapiens) [TaxId: 9606]}
arircpkgskaygshcyalflspkswtdadlacqkrpsgnlvsvlsgaegsfvsslvksi
gnsysyvwiglhdptqgtepngegwewsssdvmnyfawernpstisspghcaslsrstaf
lrwkdyncnvrlpyvckftd

Sequence, based on observed residues (ATOM records): (download)

>d1uv0a_ d.169.1.1 (A:) Pancreatitis-associated protein 1 {Human (Homo sapiens) [TaxId: 9606]}
arircpkgskaygshcyalflspkswtdadlacqkrpsgnlvsvlsgaegsfvsslvksi
gnsysyvwiglhdptqgtegegwewsssdvmnyfawernpstisspghcaslsrstaflr
wkdyncnvrlpyvckftd

SCOPe Domain Coordinates for d1uv0a_:

Click to download the PDB-style file with coordinates for d1uv0a_.
(The format of our PDB-style files is described here.)

Timeline for d1uv0a_: