![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
![]() | Superfamily d.169.1: C-type lectin-like [56436] (9 families) ![]() |
![]() | Family d.169.1.1: C-type lectin domain [56437] (29 proteins) Pfam PF00059 |
![]() | Protein Pancreatitis-associated protein 1 [103341] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [103342] (1 PDB entry) |
![]() | Domain d1uv0a_: 1uv0 A: [100028] complexed with zn |
PDB Entry: 1uv0 (more details), 1.78 Å
SCOPe Domain Sequences for d1uv0a_:
Sequence, based on SEQRES records: (download)
>d1uv0a_ d.169.1.1 (A:) Pancreatitis-associated protein 1 {Human (Homo sapiens) [TaxId: 9606]} arircpkgskaygshcyalflspkswtdadlacqkrpsgnlvsvlsgaegsfvsslvksi gnsysyvwiglhdptqgtepngegwewsssdvmnyfawernpstisspghcaslsrstaf lrwkdyncnvrlpyvckftd
>d1uv0a_ d.169.1.1 (A:) Pancreatitis-associated protein 1 {Human (Homo sapiens) [TaxId: 9606]} arircpkgskaygshcyalflspkswtdadlacqkrpsgnlvsvlsgaegsfvsslvksi gnsysyvwiglhdptqgtegegwewsssdvmnyfawernpstisspghcaslsrstaflr wkdyncnvrlpyvckftd
Timeline for d1uv0a_: