Lineage for d1uuzb1 (1uuz B:2-129)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2240542Fold d.233: Inhibitor of vertebrate lysozyme, Ivy [89871] (1 superfamily)
    alpha(2)-beta(5)-alpha(2); 3 layers a/b/a; meander beta-sheet
  4. 2240543Superfamily d.233.1: Inhibitor of vertebrate lysozyme, Ivy [89872] (1 family) (S)
    automatically mapped to Pfam PF08816
  5. 2240544Family d.233.1.1: Inhibitor of vertebrate lysozyme, Ivy [89873] (2 proteins)
  6. 2240545Protein Inhibitor of vertebrate lysozyme, Ivy [89874] (2 species)
    formerly hypothetical protein YkfE
  7. 2240552Species Pseudomonas aeruginosa [TaxId:287] [89876] (2 PDB entries)
  8. 2240554Domain d1uuzb1: 1uuz B:2-129 [100025]
    Other proteins in same PDB: d1uuza2, d1uuzb2, d1uuzc_, d1uuzd_
    complexed with lysozyme

Details for d1uuzb1

PDB Entry: 1uuz (more details), 1.8 Å

PDB Description: ivy:a new family of protein
PDB Compounds: (B:) inhibitor of vertebrate lysozyme

SCOPe Domain Sequences for d1uuzb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uuzb1 d.233.1.1 (B:2-129) Inhibitor of vertebrate lysozyme, Ivy {Pseudomonas aeruginosa [TaxId: 287]}
eqprlfellgqpgykatwhamfkgesdvpkwvsdasgpsspstslslegqpyvlansckp
hdcgnnrllvafrgdksaayglqvslpdepaevmqtpskyatyrwygepsrqvrellmkq
lesdpnwk

SCOPe Domain Coordinates for d1uuzb1:

Click to download the PDB-style file with coordinates for d1uuzb1.
(The format of our PDB-style files is described here.)

Timeline for d1uuzb1: