Lineage for d1uuzb_ (1uuz B:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1447206Fold d.233: Inhibitor of vertebrate lysozyme, Ivy [89871] (1 superfamily)
    alpha(2)-beta(5)-alpha(2); 3 layers a/b/a; meander beta-sheet
  4. 1447207Superfamily d.233.1: Inhibitor of vertebrate lysozyme, Ivy [89872] (1 family) (S)
    automatically mapped to Pfam PF08816
  5. 1447208Family d.233.1.1: Inhibitor of vertebrate lysozyme, Ivy [89873] (1 protein)
  6. 1447209Protein Inhibitor of vertebrate lysozyme, Ivy [89874] (2 species)
    formerly hypothetical protein YkfE
  7. 1447216Species Pseudomonas aeruginosa [TaxId:287] [89876] (1 PDB entry)
  8. 1447218Domain d1uuzb_: 1uuz B: [100025]
    Other proteins in same PDB: d1uuzc_, d1uuzd_
    complexed with lysozyme

Details for d1uuzb_

PDB Entry: 1uuz (more details), 1.8 Å

PDB Description: ivy:a new family of protein
PDB Compounds: (B:) inhibitor of vertebrate lysozyme

SCOPe Domain Sequences for d1uuzb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uuzb_ d.233.1.1 (B:) Inhibitor of vertebrate lysozyme, Ivy {Pseudomonas aeruginosa [TaxId: 287]}
eqprlfellgqpgykatwhamfkgesdvpkwvsdasgpsspstslslegqpyvlansckp
hdcgnnrllvafrgdksaayglqvslpdepaevmqtpskyatyrwygepsrqvrellmkq
lesdpnwkl

SCOPe Domain Coordinates for d1uuzb_:

Click to download the PDB-style file with coordinates for d1uuzb_.
(The format of our PDB-style files is described here.)

Timeline for d1uuzb_: