Lineage for d1uuza_ (1uuz A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 616636Fold d.233: Inhibitor of vertebrate lysozyme, Ivy [89871] (1 superfamily)
    alpha(2)-beta(5)-alpha(2); 3 layers a/b/a; meander beta-sheet
  4. 616637Superfamily d.233.1: Inhibitor of vertebrate lysozyme, Ivy [89872] (1 family) (S)
  5. 616638Family d.233.1.1: Inhibitor of vertebrate lysozyme, Ivy [89873] (1 protein)
  6. 616639Protein Inhibitor of vertebrate lysozyme, Ivy [89874] (2 species)
    formerly hypothetical protein YkfE
  7. 616646Species Pseudomonas aeruginosa [TaxId:287] [89876] (1 PDB entry)
  8. 616647Domain d1uuza_: 1uuz A: [100024]
    Other proteins in same PDB: d1uuzc_, d1uuzd_

Details for d1uuza_

PDB Entry: 1uuz (more details), 1.8 Å

PDB Description: ivy:a new family of protein

SCOP Domain Sequences for d1uuza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uuza_ d.233.1.1 (A:) Inhibitor of vertebrate lysozyme, Ivy {Pseudomonas aeruginosa}
eeqprlfellgqpgykatwhamfkgesdvpkwvsdasgpsspstslslegqpyvlansck
phdcgnnrllvafrgdksaayglqvslpdepaevmqtpskyatyrwygepsrqvrellmk
qlesdpnwkl

SCOP Domain Coordinates for d1uuza_:

Click to download the PDB-style file with coordinates for d1uuza_.
(The format of our PDB-style files is described here.)

Timeline for d1uuza_: